Lineage for d5db2a2 (5db2 A:231-548)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726689Protein Menin C-terminal domain [310725] (2 species)
  7. 2726690Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries)
  8. 2726700Domain d5db2a2: 5db2 A:231-548 [313335]
    Other proteins in same PDB: d5db2a1, d5db2a3
    automated match to d4gpqa2
    complexed with 58r, dms, peg, pg4, so4

    has additional insertions and/or extensions that are not grouped together

Details for d5db2a2

PDB Entry: 5db2 (more details), 1.54 Å

PDB Description: menin in complex with mi-389
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5db2a2:

Sequence, based on SEQRES records: (download)

>d5db2a2 a.118.8.1 (A:231-548) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppeg

Sequence, based on observed residues (ATOM records): (download)

>d5db2a2 a.118.8.1 (A:231-548) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsg

SCOPe Domain Coordinates for d5db2a2:

Click to download the PDB-style file with coordinates for d5db2a2.
(The format of our PDB-style files is described here.)

Timeline for d5db2a2: