SCOPe 2.08: Domain d5db1a2: 5db1 A:231-459

Lineage for d5db1a2 (5db1 A:231-459)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Menin C-terminal domain [310725] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries)

8. Domain d5db1a2: 5db1 A:231-459 [313334]
   Other proteins in same PDB: d5db1a1, d5db1a3
   automated match to d4gpqa2
   complexed with 58o, dms, pg4, so4
   has additional insertions and/or extensions that are not grouped together

Details for d5db1a2

PDB Entry: 5db1, 1.86 Å

PDB Description: menin in complex with mi-336

PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5db1a2:

Sequence; same for both SEQRES and ATOM records:

>d5db1a2 a.118.8.1 (A:231-459) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivs

Timeline for d5db1a2:

• d5db1a2 first appeared in SCOPe 2.06
  
• d5db1a2 appears in SCOPe 2.07