SCOP 1.67: Domain d1qozb_: 1qoz B:

Lineage for d1qozb_ (1qoz B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (2 proteins)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold

6. Protein Acetylxylan esterase [52263] (2 species)

7. Species Trichoderma reesei [TaxId:51453] [52265] (1 PDB entry)

8. Domain d1qozb_: 1qoz B: [31333]
   complexed with nag

Details for d1qozb_

PDB Entry: 1qoz, 1.9 Å

PDB Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei

SCOP Domain Sequences for d1qozb_:

Sequence; same for both SEQRES and ATOM records:

>d1qozb_ c.69.1.30 (B:) Acetylxylan esterase {Trichoderma reesei}
ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
gndpnvhqgygqeygqqalafinsql

Timeline for d1qozb_:

• d1qozb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qozb_ appears in SCOP 1.65
  
• d1qozb_ appears in SCOP 1.69
  
• d1qozb_ appears in the current release, SCOPe 2.08