SCOP 1.61: Domain d1qozb_: 1qoz B:

Lineage for d1qozb_ (1qoz B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.9: Cutinase-like [52259] (1 family)

5. Family c.23.9.1: Cutinase-like [52260] (2 proteins)

6. Protein Acetylxylan esterase [52263] (2 species)

7. Species Trichoderma reesei [TaxId:51453] [52265] (1 PDB entry)

8. Domain d1qozb_: 1qoz B: [31333]

Details for d1qozb_

PDB Entry: 1qoz, 1.9 Å

PDB Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei

SCOP Domain Sequences for d1qozb_:

Sequence; same for both SEQRES and ATOM records:

>d1qozb_ c.23.9.1 (B:) Acetylxylan esterase {Trichoderma reesei}
ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
gndpnvhqgygqeygqqalafinsql

Timeline for d1qozb_:

• d1qozb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qozb_ appears in SCOP 1.59
  
• d1qozb_ appears in SCOP 1.63
  
• d1qozb_ appears in the current release, SCOPe 2.08