SCOP 1.67: Domain d1qoza_: 1qoz A:

Lineage for d1qoza_ (1qoz A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (2 proteins)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold

6. Protein Acetylxylan esterase [52263] (2 species)

7. Species Trichoderma reesei [TaxId:51453] [52265] (1 PDB entry)

8. Domain d1qoza_: 1qoz A: [31332]

Details for d1qoza_

PDB Entry: 1qoz, 1.9 Å

PDB Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei

SCOP Domain Sequences for d1qoza_:

Sequence; same for both SEQRES and ATOM records:

>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei}
ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
gndpnvhqgygqeygqqalafinsqls

Timeline for d1qoza_:

• d1qoza_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoza_ appears in SCOP 1.65
  
• d1qoza_ appears in SCOP 1.69
  
• d1qoza_ appears in the current release, SCOPe 2.08