SCOP 1.63: Domain d1qoza_: 1qoz A:

Lineage for d1qoza_ (1qoz A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.9: Cutinase-like [52259] (1 family)

5. Family c.23.9.1: Cutinase-like [52260] (2 proteins)
   this family can be also classified into alpha/beta hydrolase superfamily

6. Protein Acetylxylan esterase [52263] (2 species)

7. Species Trichoderma reesei [TaxId:51453] [52265] (1 PDB entry)

8. Domain d1qoza_: 1qoz A: [31332]

Details for d1qoza_

PDB Entry: 1qoz, 1.9 Å

PDB Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei

SCOP Domain Sequences for d1qoza_:

Sequence; same for both SEQRES and ATOM records:

>d1qoza_ c.23.9.1 (A:) Acetylxylan esterase {Trichoderma reesei}
ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
gndpnvhqgygqeygqqalafinsqls

Timeline for d1qoza_:

• d1qoza_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoza_ appears in SCOP 1.61
  
• d1qoza_ appears in SCOP 1.65
  
• d1qoza_ appears in the current release, SCOPe 2.08