SCOPe 2.08: Domain d5d4ic1: 5d4i C:6-161

Lineage for d5d4ic1 (5d4i C:6-161)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)

8. Domain d5d4ic1: 5d4i C:6-161 [313317]
   Other proteins in same PDB: d5d4ia3, d5d4ib3
   automated match to d1zdsa1
   complexed with cu, no2

Details for d5d4ic1

PDB Entry: 5d4i, 1.6 Å

PDB Description: intact nitrite complex of a copper nitrite reductase determined by serial femtosecond crystallography

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5d4ic1:

Sequence; same for both SEQRES and ATOM records:

>d5d4ic1 b.6.1.0 (C:6-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
aaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafn
gtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfk
atkpgvfvyhcappgmvpwhvvsgmngaimvlpreg

Timeline for d5d4ic1:

• d5d4ic1 first appeared in SCOPe 2.06
  
• d5d4ic1 appears in SCOPe 2.07