Lineage for d5d85a_ (5d85 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2908056Species Staphylococcus aureus [TaxId:426430] [313311] (4 PDB entries)
  8. 2908060Domain d5d85a_: 5d85 A: [313312]
    automated match to d4aecb_
    complexed with flc, gol, p1t

Details for d5d85a_

PDB Entry: 5d85 (more details), 1.92 Å

PDB Description: staphyloferrin b precursor biosynthetic enzyme sbna bound to aminoacrylate intermediate
PDB Compounds: (A:) Probable siderophore biosynthesis protein SbnA

SCOPe Domain Sequences for d5d85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d85a_ c.79.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
hdslldsvgqtpmvqlhqlfpkhevfakleymnpggsmkdrpakyiiehgikhglitent
hliestsgnlgialamiakikglkltcvvdpkisptnlkiiksyganvemveepdahggy
lmtriakvqellatiddaywinqyanelnwqshyhgagteivetikqpidyfvapvsttg
simgmsrkikevhpnaqivavdakgsvifgdkpinrelpgigasrvpeilnrseinqvih
vddyqsalgcrklidyegifaggstgsiiaaieqlitsieegativtilpdrgdryldlv
ysdtwlekmksrq

SCOPe Domain Coordinates for d5d85a_:

Click to download the PDB-style file with coordinates for d5d85a_.
(The format of our PDB-style files is described here.)

Timeline for d5d85a_: