![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:426430] [313311] (4 PDB entries) |
![]() | Domain d5d85a_: 5d85 A: [313312] automated match to d4aecb_ complexed with flc, gol, p1t |
PDB Entry: 5d85 (more details), 1.92 Å
SCOPe Domain Sequences for d5d85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d85a_ c.79.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]} hdslldsvgqtpmvqlhqlfpkhevfakleymnpggsmkdrpakyiiehgikhglitent hliestsgnlgialamiakikglkltcvvdpkisptnlkiiksyganvemveepdahggy lmtriakvqellatiddaywinqyanelnwqshyhgagteivetikqpidyfvapvsttg simgmsrkikevhpnaqivavdakgsvifgdkpinrelpgigasrvpeilnrseinqvih vddyqsalgcrklidyegifaggstgsiiaaieqlitsieegativtilpdrgdryldlv ysdtwlekmksrq
Timeline for d5d85a_: