| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
| Domain d5d4hc2: 5d4h C:162-340 [313302] Other proteins in same PDB: d5d4hb3, d5d4hc3 automated match to d2e86a2 complexed with acy, cu, gol, no2 |
PDB Entry: 5d4h (more details), 1.3 Å
SCOPe Domain Sequences for d5d4hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d4hc2 b.6.1.0 (C:162-340) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
Timeline for d5d4hc2: