Lineage for d5d6jb_ (5d6j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. 2932426Domain d5d6jb_: 5d6j B: [313292]
    automated match to d1l2na_
    complexed with atp, mg

Details for d5d6jb_

PDB Entry: 5d6j (more details), 2.25 Å

PDB Description: crystal structure of a mycobacterial protein
PDB Compounds: (B:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d5d6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d6jb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
ldmedndiieahre

SCOPe Domain Coordinates for d5d6jb_:

Click to download the PDB-style file with coordinates for d5d6jb_.
(The format of our PDB-style files is described here.)

Timeline for d5d6jb_: