| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold automatically mapped to Pfam PF01083 |
| Protein Cutinase [52261] (1 species) |
| Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries) |
| Domain d1cudc_: 1cud C: [31328] mutant |
PDB Entry: 1cud (more details), 2.7 Å
SCOPe Domain Sequences for d1cudc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cudc_ c.69.1.30 (C:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
gpapefliekvravrgs
Timeline for d1cudc_: