| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
| Protein automated matches [190821] (1 species) not a true protein |
| Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries) |
| Domain d4y5z7_: 4y5z 7: [313180] automated match to d1x36a_ complexed with so4 |
PDB Entry: 4y5z (more details), 2.95 Å
SCOPe Domain Sequences for d4y5z7_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y5z7_ b.121.4.7 (7:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
ctytiqmiepta
Timeline for d4y5z7_:
View in 3DDomains from other chains: (mouse over for more information) d4y5z0_, d4y5z1_, d4y5z2_, d4y5z3_, d4y5z4_, d4y5z5_, d4y5z6_, d4y5za_, d4y5zb_, d4y5zc_, d4y5zd_, d4y5ze_, d4y5zf_, d4y5zg_, d4y5zh_, d4y5zi_, d4y5zj_, d4y5zk_, d4y5zl_, d4y5zm_, d4y5zn_, d4y5zo_, d4y5zp_, d4y5zq_, d4y5zr_, d4y5zs_, d4y5zt_, d4y5zu_, d4y5zv_, d4y5zw_, d4y5zx_, d4y5zy_, d4y5zz_ |