Lineage for d5cfib_ (5cfi B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971941Species Plasmodium falciparum [TaxId:36329] [312746] (2 PDB entries)
  8. 2971944Domain d5cfib_: 5cfi B: [313162]
    automated match to d1kt9a_

Details for d5cfib_

PDB Entry: 5cfi (more details), 2.6 Å

PDB Description: structural and functional attributes of malaria parasite ap4a hydrolase
PDB Compounds: (B:) BIS(5'-nucleosyl)-tetraphosphatase (Diadenosine tetraphosphatase), putative

SCOPe Domain Sequences for d5cfib_:

Sequence, based on SEQRES records: (download)

>d5cfib_ d.113.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
iikafgillcrlkkynpvttgdinkfeflflkasyadkhwtppkglhennesgletavre
tleetginkdkykllnyqktlkynvkdkpkettyylamllnneenvilsdehtdykwigs
hesdtynlpesladllkeaeeflnk

Sequence, based on observed residues (ATOM records): (download)

>d5cfib_ d.113.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
iikafgillcrlkkynpvttgdinkfeflflkasyadkhwtppkglhensgletavretl
eetginkdkykllnyqktlkynvkdkpkettyylamllnneenvilsdehtdykwigshe
sdtynlpesladllkeaeeflnk

SCOPe Domain Coordinates for d5cfib_:

Click to download the PDB-style file with coordinates for d5cfib_.
(The format of our PDB-style files is described here.)

Timeline for d5cfib_: