Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (17 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [312746] (2 PDB entries) |
Domain d5cfib_: 5cfi B: [313162] automated match to d1kt9a_ |
PDB Entry: 5cfi (more details), 2.6 Å
SCOPe Domain Sequences for d5cfib_:
Sequence, based on SEQRES records: (download)
>d5cfib_ d.113.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} iikafgillcrlkkynpvttgdinkfeflflkasyadkhwtppkglhennesgletavre tleetginkdkykllnyqktlkynvkdkpkettyylamllnneenvilsdehtdykwigs hesdtynlpesladllkeaeeflnk
>d5cfib_ d.113.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} iikafgillcrlkkynpvttgdinkfeflflkasyadkhwtppkglhensgletavretl eetginkdkykllnyqktlkynvkdkpkettyylamllnneenvilsdehtdykwigshe sdtynlpesladllkeaeeflnk
Timeline for d5cfib_: