Lineage for d4rfrb_ (4rfr B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2081124Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2081396Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2081412Protein automated matches [191077] (2 species)
    not a true protein
  7. 2081439Species Escherichia coli [TaxId:562] [313153] (1 PDB entry)
  8. 2081440Domain d4rfrb_: 4rfr B: [313154]
    automated match to d3khca_
    complexed with mn, rhn

Details for d4rfrb_

PDB Entry: 4rfr (more details), 1.5 Å

PDB Description: complex structure of alkb/rhein
PDB Compounds: (B:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4rfrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rfrb_ b.82.2.10 (B:) automated matches {Escherichia coli [TaxId: 562]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d4rfrb_:

Click to download the PDB-style file with coordinates for d4rfrb_.
(The format of our PDB-style files is described here.)

Timeline for d4rfrb_: