Lineage for d4y4ym_ (4y4y M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822414Protein automated matches [190821] (1 species)
    not a true protein
  7. 2822415Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries)
  8. 2822465Domain d4y4ym_: 4y4y M: [313121]
    automated match to d1x36a_
    complexed with so4

Details for d4y4ym_

PDB Entry: 4y4y (more details), 3 Å

PDB Description: t=1 capsid structure of semv ndel65cp fused with b-domain of s. aureus protein spa at the n-terminus (c2 crystal form)
PDB Compounds: (M:) Immunoglobulin G-binding protein A,Coat protein

SCOPe Domain Sequences for d4y4ym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y4ym_ b.121.4.7 (M:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmiepta

SCOPe Domain Coordinates for d4y4ym_:

Click to download the PDB-style file with coordinates for d4y4ym_.
(The format of our PDB-style files is described here.)

Timeline for d4y4ym_: