Lineage for d1cuc__ (1cuc -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68496Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 68497Family c.23.9.1: Cutinase-like [52260] (2 proteins)
  6. 68506Protein Cutinase [52261] (1 species)
  7. 68507Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 68536Domain d1cuc__: 1cuc - [31312]

Details for d1cuc__

PDB Entry: 1cuc (more details), 1.75 Å

PDB Description: cutinase, n172k, r196d mutant, orthorhombic crystal form

SCOP Domain Sequences for d1cuc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuc__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
gpapefliekvravrgs

SCOP Domain Coordinates for d1cuc__:

Click to download the PDB-style file with coordinates for d1cuc__.
(The format of our PDB-style files is described here.)

Timeline for d1cuc__: