Lineage for d1cuc__ (1cuc -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) Superfamily c.23.9: Cutinase-like [52259] (1 family) 
Family c.23.9.1: Cutinase-like [52260] (2 proteins) 
Protein Cutinase [52261] (1 species) Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries) 
Domain d1cuc__: 1cuc - [31312]
Details for d1cuc__
PDB Entry: 1cuc (more details), 1.75 Å
PDB Description: cutinase, n172k, r196d mutant, orthorhombic crystal form
SCOP Domain Sequences for d1cuc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cuc__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
gpapefliekvravrgs
SCOP Domain Coordinates for d1cuc__:
Click to download the PDB-style file with coordinates for d1cuc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cuc__:
- d1cuc__ appears in SCOP 1.57
- d1cuc__ appears in the current release, SCOPe 2.08, called d1cuca_
View in 3D