Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [312431] (15 PDB entries) |
Domain d4z1cb_: 4z1c B: [313111] automated match to d3e0ia_ complexed with cd |
PDB Entry: 4z1c (more details), 1.93 Å
SCOPe Domain Sequences for d4z1cb_:
Sequence, based on SEQRES records: (download)
>d4z1cb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} ksvliagpcvieslenlrsiatklqplannerldfyfkasfdkanrtslesyrgpglekg lemlqtikeefgykiltdvhesyqasvaakvadilqipaflcrqtdlivevsqtnaivni kkgqfmnpkdmqysvlkalktrdksiqsptyetalkngvwlcergssfgygnlvvdmrsl kimrefapvifdathsvqmpggangkssgdssfapilaraaaavgidglfaethvdpkna lsdganmlkpdeleqlvtdmlkiqnlf
>d4z1cb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} ksvliagpcvieslenlrsiatklqplannerldfyfkasfdkanrtslesyrgpglekg lemlqtikeefgykiltdvhesyqasvaakvadilqipaflcrqtdlivevsqtnaivni kkgqfmnpkdmqysvlkalktrdksiqsptyetalkngvwlcergssfgygnlvvdmrsl kimrefapvifdathsvqmpssfapilaraaaavgidglfaethvdpknalsdganmlkp deleqlvtdmlkiqnlf
Timeline for d4z1cb_: