Lineage for d4yrad_ (4yra D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431677Species Mouse (Mus musculus) [TaxId:10090] [312116] (2 PDB entries)
  8. 2431681Domain d4yrad_: 4yra D: [313092]
    automated match to d2yy7a_

Details for d4yrad_

PDB Entry: 4yra (more details), 2.65 Å

PDB Description: mouse tdh in the apo form
PDB Compounds: (D:) L-threonine 3-dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4yrad_:

Sequence, based on SEQRES records: (download)

>d4yrad_ c.2.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
reivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstiga
fgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqpg
ggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtyni
samsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlp
elvatmlnfh

Sequence, based on observed residues (ATOM records): (download)

>d4yrad_ c.2.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
reivvnhriswlfhyslardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapd
lciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisagttdyavqifhaaakng
tfecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkha
pdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfh

SCOPe Domain Coordinates for d4yrad_:

Click to download the PDB-style file with coordinates for d4yrad_.
(The format of our PDB-style files is described here.)

Timeline for d4yrad_: