Lineage for d4z1db_ (4z1d B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (76 species)
    not a true protein
  7. 2422163Species Helicobacter pylori [TaxId:85962] [312431] (4 PDB entries)
  8. 2422165Domain d4z1db_: 4z1d B: [313091]
    automated match to d3e0ia_
    complexed with pep, zn

Details for d4z1db_

PDB Entry: 4z1d (more details), 1.65 Å

PDB Description: structure of pep and zinc bound kdo8ps from h.pylori
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d4z1db_:

Sequence, based on SEQRES records: (download)

>d4z1db_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
ksvliagpcvieslenlrsiatklqplannerldfyfkasfdkanrtslesyrgpglekg
lemlqtikeefgykiltdvhesyqasvaakvadilqipaflcrqtdlivevsqtnaivni
kkgqfmnpkdmqysvlkalktrdksiqsptyetalkngvwlcergssfgygnlvvdmrsl
kimrefapvifdathsvqmpggangkssgdssfapilaraaaavgidglfaethvdpkna
lsdganmlkpdeleqlvtdmlkiqnlf

Sequence, based on observed residues (ATOM records): (download)

>d4z1db_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
ksvliagpcvieslenlrsiatklqplannerldfyfkasfdkanrtslesyrgpglekg
lemlqtikeefgykiltdvhesyqasvaakvadilqipaflcrqtdlivevsqtnaivni
kkgqfmnpkdmqysvlkalktrdksiqsptyetalkngvwlcergssfgygnlvvdmrsl
kimrefapvifdathsvqmpsfapilaraaaavgidglfaethvdpknalsdganmlkpd
eleqlvtdmlkiqnlf

SCOPe Domain Coordinates for d4z1db_:

Click to download the PDB-style file with coordinates for d4z1db_.
(The format of our PDB-style files is described here.)

Timeline for d4z1db_: