Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries) |
Domain d4yy1a_: 4yy1 A: [313071] Other proteins in same PDB: d4yy1b_, d4yy1d_ automated match to d4xkgc_ complexed with nag |
PDB Entry: 4yy1 (more details), 3.1 Å
SCOPe Domain Sequences for d4yy1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yy1a_ b.19.1.0 (A:) automated matches {Unidentified influenza virus [TaxId: 119212]} dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl wigecpkyvkseslrlatglrnvpq
Timeline for d4yy1a_: