![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
![]() | Protein automated matches [254617] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255522] (6 PDB entries) |
![]() | Domain d5a1ia3: 5a1i A:252-395 [313069] automated match to d2p02a3 complexed with adn, edo, k, met, mg, peg, pg4, ppk, sam |
PDB Entry: 5a1i (more details), 1.09 Å
SCOPe Domain Sequences for d5a1ia3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ia3 d.130.1.0 (A:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]} iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy qrtaayghfgrdsfpwevpkklky
Timeline for d5a1ia3: