| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
| Protein automated matches [254617] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
| Domain d5a1ia1: 5a1i A:15-125 [313067] automated match to d2p02a1 complexed with adn, edo, k, met, mg, peg, pg4, ppk, sam |
PDB Entry: 5a1i (more details), 1.09 Å
SCOPe Domain Sequences for d5a1ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ia1 d.130.1.0 (A:15-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvhldr
Timeline for d5a1ia1: