Lineage for d4yvua3 (4yvu A:357-511)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771966Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)
  7. 2771994Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries)
  8. 2772006Domain d4yvua3: 4yvu A:357-511 [313065]
    Other proteins in same PDB: d4yvua2
    automated match to d3zdwa3
    complexed with cu, edo, gol

Details for d4yvua3

PDB Entry: 4yvu (more details), 2.3 Å

PDB Description: crystal structure of cota native enzyme in the acid condition, ph5.6
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4yvua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yvua3 b.6.1.3 (A:357-511) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d4yvua3:

Click to download the PDB-style file with coordinates for d4yvua3.
(The format of our PDB-style files is described here.)

Timeline for d4yvua3: