Lineage for d5a8bb_ (5a8b B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577189Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2577190Protein automated matches [190492] (24 species)
    not a true protein
  7. 2577335Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries)
  8. 2577343Domain d5a8bb_: 5a8b B: [313053]
    Other proteins in same PDB: d5a8bc2
    automated match to d5dklb_
    complexed with cl, fmn, gol

Details for d5a8bb_

PDB Entry: 5a8b (more details), 2.79 Å

PDB Description: structure of a parallel dimer of the aureochrome 1a lov domain from phaeodactylum tricornutum
PDB Compounds: (B:) ptaureo1a lov2 domain

SCOPe Domain Sequences for d5a8bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8bb_ d.110.3.0 (B:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]}
sfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgpetdpka
verirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckvsdqyaa
tvtkqqeeeee

SCOPe Domain Coordinates for d5a8bb_:

Click to download the PDB-style file with coordinates for d5a8bb_.
(The format of our PDB-style files is described here.)

Timeline for d5a8bb_: