Lineage for d4zu5a1 (4zu5 A:1-136)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (26 species)
    not a true protein
  7. 2404586Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (4 PDB entries)
  8. 2404589Domain d4zu5a1: 4zu5 A:1-136 [313050]
    Other proteins in same PDB: d4zu5a2, d4zu5b2
    automated match to d2pa7b_
    complexed with pxn, thm

Details for d4zu5a1

PDB Entry: 4zu5 (more details), 1.8 Å

PDB Description: crystal structure of the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, apo form
PDB Compounds: (A:) QdtA

SCOPe Domain Sequences for d4zu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zu5a1 b.82.1.0 (A:1-136) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
yirnydfyideakkrf

SCOPe Domain Coordinates for d4zu5a1:

Click to download the PDB-style file with coordinates for d4zu5a1.
(The format of our PDB-style files is described here.)

Timeline for d4zu5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zu5a2