Lineage for d5a1tb1 (5a1t B:4-154)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2432599Species Trichomonas vaginalis [TaxId:5722] [276010] (5 PDB entries)
  8. 2432607Domain d5a1tb1: 5a1t B:4-154 [313044]
    Other proteins in same PDB: d5a1ta2, d5a1ta3, d5a1tb2
    automated match to d4uuma1
    complexed with nai, oxm

Details for d5a1tb1

PDB Entry: 5a1t (more details), 1.97 Å

PDB Description: trichomonas vaginalis lactate dehydrogenase in complex with nadh and oxamate
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d5a1tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1tb1 c.2.1.0 (B:4-154) automated matches {Trichomonas vaginalis [TaxId: 5722]}
aahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcafph
lagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwakpsv
kvlvignpdntnceiamlhaknlkpenfssl

SCOPe Domain Coordinates for d5a1tb1:

Click to download the PDB-style file with coordinates for d5a1tb1.
(The format of our PDB-style files is described here.)

Timeline for d5a1tb1: