Lineage for d4yr7b_ (4yr7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520526Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 2520527Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)
  8. 2520530Domain d4yr7b_: 4yr7 B: [313040]
    automated match to d1zhha_
    complexed with a1b

Details for d4yr7b_

PDB Entry: 4yr7 (more details), 2.53 Å

PDB Description: structure of luxp in complex with 1-deoxy-alpha-l-xylulofuranose-1,2- borate
PDB Compounds: (B:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d4yr7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yr7b_ c.93.1.1 (B:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
ngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrn
iasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfve
hvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvly
fsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacs
tdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikw
dledkpvptvysgdfeivtkadsperiealkkrafrysdn

SCOPe Domain Coordinates for d4yr7b_:

Click to download the PDB-style file with coordinates for d4yr7b_.
(The format of our PDB-style files is described here.)

Timeline for d4yr7b_: