Lineage for d1cuf__ (1cuf -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22108Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 22109Family c.23.9.1: Cutinase-like [52260] (2 proteins)
  6. 22118Protein Cutinase [52261] (1 species)
  7. 22119Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 22135Domain d1cuf__: 1cuf - [31301]

Details for d1cuf__

PDB Entry: 1cuf (more details), 1.75 Å

PDB Description: cutinase, r156l mutant

SCOP Domain Sequences for d1cuf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuf__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnlgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

SCOP Domain Coordinates for d1cuf__:

Click to download the PDB-style file with coordinates for d1cuf__.
(The format of our PDB-style files is described here.)

Timeline for d1cuf__: