Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
Protein automated matches [190821] (1 species) not a true protein |
Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries) |
Domain d4y4ya_: 4y4y A: [312999] automated match to d1x36a_ complexed with so4 |
PDB Entry: 4y4y (more details), 3 Å
SCOPe Domain Sequences for d4y4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4ya_ b.121.4.7 (A:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]} gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc tytiqmiepta
Timeline for d4y4ya_: