SCOPe 2.07: Domain d5cz1c1: 5cz1 C:55-212

Lineage for d5cz1c1 (5cz1 C:55-212)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Mouse mammary tumor virus [TaxId:11757] [312887] (1 PDB entry)

8. Domain d5cz1c1: 5cz1 C:55-212 [312960]
   Other proteins in same PDB: d5cz1a2, d5cz1c2
   automated match to d1c6vb_

Details for d5cz1c1

PDB Entry: 5cz1, 1.7 Å

PDB Description: crystal structure of the catalytic core domain of mmtv integrase

PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d5cz1c1:

Sequence; same for both SEQRES and ATOM records:

>d5cz1c1 c.55.3.2 (C:55-212) automated matches {Mouse mammary tumor virus [TaxId: 11757]}
glkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymg
ipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqka
gkyytphhllahalfvlnhvnmdnqghtaaerhwgpis

Timeline for d5cz1c1:

• d5cz1c1 first appeared in SCOPe 2.06
  
• d5cz1c1 appears in the current release, SCOPe 2.08