| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
| Protein automated matches [190209] (5 species) not a true protein |
| Species Mouse mammary tumor virus [TaxId:11757] [312887] (1 PDB entry) |
| Domain d5cz1c1: 5cz1 C:55-212 [312960] Other proteins in same PDB: d5cz1a2, d5cz1c2 automated match to d1c6vb_ |
PDB Entry: 5cz1 (more details), 1.7 Å
SCOPe Domain Sequences for d5cz1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cz1c1 c.55.3.2 (C:55-212) automated matches {Mouse mammary tumor virus [TaxId: 11757]}
glkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymg
ipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqka
gkyytphhllahalfvlnhvnmdnqghtaaerhwgpis
Timeline for d5cz1c1:
View in 3DDomains from other chains: (mouse over for more information) d5cz1a1, d5cz1a2, d5cz1b_, d5cz1d_ |