Lineage for d5cz1c1 (5cz1 C:55-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886283Protein automated matches [190209] (5 species)
    not a true protein
  7. 2886459Species Mouse mammary tumor virus [TaxId:11757] [312887] (1 PDB entry)
  8. 2886462Domain d5cz1c1: 5cz1 C:55-212 [312960]
    Other proteins in same PDB: d5cz1a2, d5cz1c2
    automated match to d1c6vb_

Details for d5cz1c1

PDB Entry: 5cz1 (more details), 1.7 Å

PDB Description: crystal structure of the catalytic core domain of mmtv integrase
PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d5cz1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cz1c1 c.55.3.2 (C:55-212) automated matches {Mouse mammary tumor virus [TaxId: 11757]}
glkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymg
ipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqka
gkyytphhllahalfvlnhvnmdnqghtaaerhwgpis

SCOPe Domain Coordinates for d5cz1c1:

Click to download the PDB-style file with coordinates for d5cz1c1.
(The format of our PDB-style files is described here.)

Timeline for d5cz1c1: