Class b: All beta proteins [48724] (178 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
Domain d5aewk1: 5aew K:18-179 [312943] Other proteins in same PDB: d5aewa2, d5aewb_, d5aewc2, d5aewd_, d5aewe2, d5aewf_, d5aewg2, d5aewh_, d5aewi2, d5aewj_, d5aewk2, d5aewl_, d5aewm2, d5aewn_, d5aewo2, d5aewp_, d5aewq2, d5aewr_, d5aews2, d5aewt_, d5aewu2, d5aewv_, d5aeww2, d5aewx_ automated match to d2yfia1 complexed with bnl, fe2, fes |
PDB Entry: 5aew (more details), 1.88 Å
SCOPe Domain Sequences for d5aewk1:
Sequence, based on SEQRES records: (download)
>d5aewk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d5aewk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d5aewk1:
View in 3D Domains from other chains: (mouse over for more information) d5aewa1, d5aewa2, d5aewb_, d5aewc1, d5aewc2, d5aewd_, d5aewe1, d5aewe2, d5aewf_, d5aewg1, d5aewg2, d5aewh_, d5aewi1, d5aewi2, d5aewj_, d5aewl_, d5aewm1, d5aewm2, d5aewn_, d5aewo1, d5aewo2, d5aewp_, d5aewq1, d5aewq2, d5aewr_, d5aews1, d5aews2, d5aewt_, d5aewu1, d5aewu2, d5aewv_, d5aeww1, d5aeww2, d5aewx_ |