Lineage for d5aewk1 (5aew K:18-179)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2392187Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2392188Protein automated matches [190701] (13 species)
    not a true protein
  7. 2392194Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)
  8. 2392230Domain d5aewk1: 5aew K:18-179 [312943]
    Other proteins in same PDB: d5aewa2, d5aewb_, d5aewc2, d5aewd_, d5aewe2, d5aewf_, d5aewg2, d5aewh_, d5aewi2, d5aewj_, d5aewk2, d5aewl_, d5aewm2, d5aewn_, d5aewo2, d5aewp_, d5aewq2, d5aewr_, d5aews2, d5aewt_, d5aewu2, d5aewv_, d5aeww2, d5aewx_
    automated match to d2yfia1
    complexed with bnl, fe2, fes

Details for d5aewk1

PDB Entry: 5aew (more details), 1.88 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
PDB Compounds: (K:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d5aewk1:

Sequence, based on SEQRES records: (download)

>d5aewk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d5aewk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d5aewk1:

Click to download the PDB-style file with coordinates for d5aewk1.
(The format of our PDB-style files is described here.)

Timeline for d5aewk1: