| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
| Protein automated matches [190988] (51 species) not a true protein |
| Species Aichivirus a [TaxId:72149] [312940] (1 PDB entry) |
| Domain d5aooc_: 5aoo C: [312941] automated match to d1ncqc_ |
PDB Entry: 5aoo (more details), 2.1 Å
SCOPe Domain Sequences for d5aooc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aooc_ b.121.4.0 (C:) automated matches {Aichivirus a [TaxId: 72149]}
hwktravpgagtfgsavagqelplcgvrayyppnayipaqvrdwlefahrpglmatvpwt
madepaerlgifpvspsaiagtgapisyvislfsqwrgelaahllftgsaqhygrlvvcy
tpaapqppstmqeamrgtytvwdvnaastleftipfisnsywktvdvnnpdallsttgyv
siwvqnplvgphtapasalvqafisagesfnvrlmqnpal
Timeline for d5aooc_: