SCOP 1.73: Domain d1cuja_: 1cuj A:

Lineage for d1cuja_ (1cuj A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (2 proteins)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold

6. Protein Cutinase [52261] (1 species)

7. Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)

8. Domain d1cuja_: 1cuj A: [31294]
   mutant

Details for d1cuja_

PDB Entry: 1cuj, 1.6 Å

PDB Description: cutinase, s120c mutant

PDB Compounds: (A:) cutinase

SCOP Domain Sequences for d1cuja_:

Sequence; same for both SEQRES and ATOM records:

>d1cuja_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggycqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

Timeline for d1cuja_:

• d1cuja_ first appeared (with stable ids) in SCOP 1.55, called d1cuj__
  
• d1cuja_ was called d1cuj__ in SCOP 1.71
  
• d1cuja_ appears in SCOP 1.75
  
• d1cuja_ appears in the current release, SCOPe 2.08