| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.1: MutT-like [55812] (17 proteins) |
| Protein automated matches [190465] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries) |
| Domain d5anta_: 5ant A: [312938] automated match to d1irya_ complexed with rje |
PDB Entry: 5ant (more details), 2 Å
SCOPe Domain Sequences for d5anta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5anta_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltv
dalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdds
ywfplllqkkkfhgyfkfqgqdtildytlrevdtv
Timeline for d5anta_: