![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282458] [312718] (3 PDB entries) |
![]() | Domain d5cm5b1: 5cm5 B:1-263 [312935] Other proteins in same PDB: d5cm5b2, d5cm5d2 automated match to d3hpda_ |
PDB Entry: 5cm5 (more details), 2.09 Å
SCOPe Domain Sequences for d5cm5b1:
Sequence, based on SEQRES records: (download)
>d5cm5b1 c.72.1.0 (B:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilaliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangsp llarvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspl lldtlyhlnettyqqririqeve
>d5cm5b1 c.72.1.0 (B:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]} mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase ilalidldavtiakkayaiyktaivitgkedvivqgdkaivlangspllarvtgagcllg giiagflfretepdiealieavsvfniaaevaaenencggpgtfspllldtlyhlnetty qqririqeve
Timeline for d5cm5b1: