SCOPe 2.06: Domain d5ctya_: 5cty A:

Lineage for d5ctya_ (5cty A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (14 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries)

8. Domain d5ctya_: 5cty A: [312930]
   automated match to d3u2ka_
   protein/DNA complex; complexed with 55h, cl, mg, mpd

Details for d5ctya_

PDB Entry: 5cty, 1.6 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d5ctya_:

Sequence; same for both SEQRES and ATOM records:

>d5ctya_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
eenvredsyhye

Timeline for d5ctya_:

• d5ctya_ is new in SCOPe 2.06-stable
  
• d5ctya_ appears in SCOPe 2.07
  
• d5ctya_ appears in the current release, SCOPe 2.08