SCOPe 2.08: Domain d5cgla_: 5cgl A:

Lineage for d5cgla_ (5cgl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.265: Fic-like [140930] (1 superfamily)
   multihelical; one central helix is surrounded by seven helices

4. Superfamily a.265.1: Fic-like [140931] (1 family)

5. Family a.265.1.1: Fic-like [140932] (3 proteins)
   Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix

6. Protein automated matches [191277] (4 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)

8. Domain d5cgla_: 5cgl A: [312915]
   automated match to d3s6aa_
   complexed with peg; mutant

Details for d5cgla_

PDB Entry: 5cgl, 2.35 Å

PDB Description: fic protein from neisseria meningitidis (nmfic) mutant e102r in dimeric form

PDB Compounds: (A:) adenosine monophosphate-protein transferase nmfic

SCOPe Domain Sequences for d5cgla_:

Sequence, based on SEQRES records:

>d5cgla_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvrmniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyegye

Sequence, based on observed residues (ATOM records):

>d5cgla_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqirlkealvkieqm
pertfeeiiakyvrmniahpflegngrstriwldlvlkknlkkvvnwqnvsktlylqame
rspvndlelrfllkdnltddvdnreiifkgieqsyyyegye

Timeline for d5cgla_:

• d5cgla_ first appeared in SCOPe 2.06
  
• d5cgla_ appears in SCOPe 2.07