Lineage for d5cgla_ (5cgl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343769Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2343770Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2343771Family a.265.1.1: Fic-like [140932] (3 protein domains)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2343779Protein automated matches [191277] (3 species)
    not a true protein
  7. 2343784Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)
  8. 2343791Domain d5cgla_: 5cgl A: [312915]
    automated match to d3s6aa_
    complexed with peg; mutant

Details for d5cgla_

PDB Entry: 5cgl (more details), 2.35 Å

PDB Description: fic protein from neisseria meningitidis (nmfic) mutant e102r in dimeric form
PDB Compounds: (A:) adenosine monophosphate-protein transferase nmfic

SCOPe Domain Sequences for d5cgla_:

Sequence, based on SEQRES records: (download)

>d5cgla_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvrmniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyegye

Sequence, based on observed residues (ATOM records): (download)

>d5cgla_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqirlkealvkieqm
pertfeeiiakyvrmniahpflegngrstriwldlvlkknlkkvvnwqnvsktlylqame
rspvndlelrfllkdnltddvdnreiifkgieqsyyyegye

SCOPe Domain Coordinates for d5cgla_:

Click to download the PDB-style file with coordinates for d5cgla_.
(The format of our PDB-style files is described here.)

Timeline for d5cgla_: