SCOPe 2.08: Domain d5cd3h1: 5cd3 H:2-108

Lineage for d5cd3h1 (5cd3 H:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5cd3h1: 5cd3 H:2-108 [312908]
   Other proteins in same PDB: d5cd3b2, d5cd3d2, d5cd3f2, d5cd3h2
   automated match to d1dn0a1

Details for d5cd3h1

PDB Entry: 5cd3, 2.9 Å

PDB Description: structure of immature vrc01-class antibody drvia7

PDB Compounds: (H:) DRVIA7 Light Chain

SCOPe Domain Sequences for d5cd3h1:

Sequence; same for both SEQRES and ATOM records:

>d5cd3h1 b.1.1.0 (H:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspvtlsasigdrvtitcrasqridnwvawyqqkpgrapklliykasiletgvpsr
fsgsgsgteftlsinslqpddvatyycqqfeefgrgtkidi

Timeline for d5cd3h1:

• d5cd3h1 first appeared in SCOPe 2.06
  
• d5cd3h1 appears in SCOPe 2.07