Lineage for d5b3ab_ (5b3a B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2514910Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2514911Species Aeropyrum pernix [TaxId:56636] [142742] (7 PDB entries)
    Uniprot Q9YBL2 1-382
  8. 2514931Domain d5b3ab_: 5b3a B: [312886]
    automated match to d1wkva1
    complexed with 0jo, mpd

Details for d5b3ab_

PDB Entry: 5b3a (more details), 2.14 Å

PDB Description: crystal structure of o-phoshoserine sulfhydrylase from aeropyrum pernix in complexed with the alpha-aminoacrylate intermediate
PDB Compounds: (B:) Protein CysO

SCOPe Domain Sequences for d5b3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3ab_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cysteine synthase) {Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnaleg

SCOPe Domain Coordinates for d5b3ab_:

Click to download the PDB-style file with coordinates for d5b3ab_.
(The format of our PDB-style files is described here.)

Timeline for d5b3ab_: