SCOPe 2.08: Domain d5b3ab_: 5b3a B:

Lineage for d5b3ab_ (5b3a B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)

7. Species Aeropyrum pernix [TaxId:56636] [142742] (7 PDB entries)
   Uniprot Q9YBL2 1-382

8. Domain d5b3ab_: 5b3a B: [312886]
   automated match to d1wkva1
   complexed with 0jo, mpd

Details for d5b3ab_

PDB Entry: 5b3a, 2.14 Å

PDB Description: crystal structure of o-phoshoserine sulfhydrylase from aeropyrum pernix in complexed with the alpha-aminoacrylate intermediate

PDB Compounds: (B:) Protein CysO

SCOPe Domain Sequences for d5b3ab_:

Sequence; same for both SEQRES and ATOM records:

>d5b3ab_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cysteine synthase) {Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnaleg

Timeline for d5b3ab_:

• d5b3ab_ first appeared in SCOPe 2.06
  
• d5b3ab_ appears in SCOPe 2.07