SCOPe 2.06: Domain d5cpmb_: 5cpm B:

Lineage for d5cpmb_ (5cpm B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (21 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [187793] (24 PDB entries)

8. Domain d5cpmb_: 5cpm B: [312871]
   automated match to d3l65a_
   complexed with fnr, ndp

Details for d5cpmb_

PDB Entry: 5cpm, 1.5 Å

PDB Description: xena from pseudomonas putida in complex with nadph4.

PDB Compounds: (B:) xenobiotic reductase

SCOPe Domain Sequences for d5cpmb_:

Sequence; same for both SEQRES and ATOM records:

>d5cpmb_ c.1.4.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiga
ddargwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfah
gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
eqtleesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvtsa
wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

Timeline for d5cpmb_:

• d5cpmb_ is new in SCOPe 2.06-stable
  
• d5cpmb_ appears in SCOPe 2.07
  
• d5cpmb_ appears in the current release, SCOPe 2.08