SCOPe 2.06: Domain d5cgae1: 5cga E:1-263

Lineage for d5cgae1 (5cga E:1-263)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (40 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [312718] (3 PDB entries)

8. Domain d5cgae1: 5cga E:1-263 [312864]
   Other proteins in same PDB: d5cgaa2, d5cgae2
   automated match to d3hpda_
   complexed with kp6, mg

Details for d5cgae1

PDB Entry: 5cga, 1.87 Å

PDB Description: structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with substrate analog 2-(1,3,5-trimethyl-1h- pyrazole-4-yl)ethanol

PDB Compounds: (E:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d5cgae1:

Sequence, based on SEQRES records:

>d5cgae1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]}
mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini
gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase
ilaliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangsp
llarvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspl
lldtlyhlnettyqqririqeve

Sequence, based on observed residues (ATOM records):

>d5cgae1 c.72.1.0 (E:1-263) automated matches {Staphylococcus aureus [TaxId: 282458]}
mnylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallini
gtltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnase
ilalidldavtiakkayaiyktaivitgkedvivqgdkaivlangspllarvtgagcllg
giiagflfretepdiealieavsvfniaaevaaenencggpgtfspllldtlyhlnetty
qqririqeve

Timeline for d5cgae1:

• d5cgae1 is new in SCOPe 2.06-stable
  
• d5cgae1 appears in SCOPe 2.07
  
• d5cgae1 appears in the current release, SCOPe 2.08