Lineage for d5cnsd2 (5cns D:222-737)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434269Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2434270Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2434298Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
    automatically mapped to Pfam PF02867
  6. 2434299Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 2434300Species Escherichia coli [TaxId:562] [52004] (10 PDB entries)
  8. 2434326Domain d5cnsd2: 5cns D:222-737 [312856]
    Other proteins in same PDB: d5cnsa1, d5cnsb1, d5cnsc1, d5cnsd1
    automated match to d2r1ra2
    complexed with cdp, dat, dtp, feo, mg

Details for d5cnsd2

PDB Entry: 5cns (more details), 2.98 Å

PDB Description: crystal structure of the datp inhibited e. coli class ia ribonucleotide reductase complex bound to cdp and datp at 2.97 angstroms resolution
PDB Compounds: (D:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d5cnsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cnsd2 c.7.1.2 (D:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrdg

SCOPe Domain Coordinates for d5cnsd2:

Click to download the PDB-style file with coordinates for d5cnsd2.
(The format of our PDB-style files is described here.)

Timeline for d5cnsd2: