SCOPe 2.06: Domain d5crub_: 5cru B:

Lineage for d5crub_ (5cru B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)

8. Domain d5crub_: 5cru B: [312843]
   automated match to d2oewa_

Details for d5crub_

PDB Entry: 5cru, 2.4 Å

PDB Description: crystal structure of the bro domain of hd-ptp

PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 23

SCOPe Domain Sequences for d5crub_:

Sequence; same for both SEQRES and ATOM records:

>d5crub_ a.118.8.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdif

Timeline for d5crub_:

• d5crub_ is new in SCOPe 2.06-stable
  
• d5crub_ appears in SCOPe 2.07
  
• d5crub_ appears in the current release, SCOPe 2.08