Lineage for d1d7ao_ (1d7a O:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68483Superfamily c.23.8: N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52255] (1 family) (S)
  5. 68484Family c.23.8.1: N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52256] (1 protein)
  6. 68485Protein N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE [52257] (1 species)
  7. 68486Species Escherichia coli [TaxId:562] [52258] (2 PDB entries)
  8. 68495Domain d1d7ao_: 1d7a O: [31284]

Details for d1d7ao_

PDB Entry: 1d7a (more details), 2.5 Å

PDB Description: crystal structure of e. coli pure-mononucleotide complex.

SCOP Domain Sequences for d1d7ao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ao_ c.23.8.1 (O:) N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) mutase PurE {Escherichia coli}
garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg

SCOP Domain Coordinates for d1d7ao_:

Click to download the PDB-style file with coordinates for d1d7ao_.
(The format of our PDB-style files is described here.)

Timeline for d1d7ao_: