Lineage for d5crud_ (5cru D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727017Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)
  8. 2727029Domain d5crud_: 5cru D: [312835]
    automated match to d2oewa_

Details for d5crud_

PDB Entry: 5cru (more details), 2.4 Å

PDB Description: crystal structure of the bro domain of hd-ptp
PDB Compounds: (D:) tyrosine-protein phosphatase non-receptor type 23

SCOPe Domain Sequences for d5crud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5crud_ a.118.8.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdif

SCOPe Domain Coordinates for d5crud_:

Click to download the PDB-style file with coordinates for d5crud_.
(The format of our PDB-style files is described here.)

Timeline for d5crud_: