Lineage for d1d7an_ (1d7a N:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481573Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 481574Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 481575Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (3 species)
  7. 481579Species Escherichia coli [TaxId:562] [52258] (2 PDB entries)
  8. 481587Domain d1d7an_: 1d7a N: [31283]

Details for d1d7an_

PDB Entry: 1d7a (more details), 2.5 Å

PDB Description: crystal structure of e. coli pure-mononucleotide complex.

SCOP Domain Sequences for d1d7an_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7an_ c.23.8.1 (N:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli}
garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg

SCOP Domain Coordinates for d1d7an_:

Click to download the PDB-style file with coordinates for d1d7an_.
(The format of our PDB-style files is described here.)

Timeline for d1d7an_: