SCOPe 2.06: Domain d5cnsc2: 5cns C:222-736

Lineage for d5cnsc2 (5cns C:222-736)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
   contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel

4. Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families)
   duplication: the N- and C-terminal halves have similar topologies

5. Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
   automatically mapped to Pfam PF02867

6. Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)

7. Species Escherichia coli [TaxId:562] [52004] (10 PDB entries)

8. Domain d5cnsc2: 5cns C:222-736 [312821]
   Other proteins in same PDB: d5cnsa1, d5cnsb1, d5cnsc1, d5cnsd1
   automated match to d2r1ra2
   complexed with cdp, dat, dtp, feo, mg

Details for d5cnsc2

PDB Entry: 5cns, 2.98 Å

PDB Description: crystal structure of the datp inhibited e. coli class ia ribonucleotide reductase complex bound to cdp and datp at 2.97 angstroms resolution

PDB Compounds: (C:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d5cnsc2:

Sequence; same for both SEQRES and ATOM records:

>d5cnsc2 c.7.1.2 (C:222-736) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrd

Timeline for d5cnsc2:

• d5cnsc2 is new in SCOPe 2.06-stable
  
• d5cnsc2 appears in SCOPe 2.07
  
• d5cnsc2 appears in the current release, SCOPe 2.08